VEGFA Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB584862
- Images (6)
| Article Name: | VEGFA Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB584862 |
| Supplier Catalog Number: | orb584862 |
| Alternative Catalog Number: | BYT-ORB584862-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Conjugation: | Unconjugated |
| Alternative Names: | VPF, VEGF, MVCD1 |
| Rabbit polyclonal antibody to VEGFA |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 40kDa |
| NCBI: | 001191314 |
| UniProt: | P15692 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVCDKPR |
| Target: | VEGFA |
|
|
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml. |
|
|
Positive control (+): Human Liver (LI), Negative control (-): Human Brain (BR), Antibody concentration: 3 ug/ml. |
|
|
Sample Type: LNCap cells, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:5000, Color/Signal Descriptions: Brown: VEGFA Blue: DAPI, Gene Name: VEGFA. |
|
|
WB Suggested Anti-VEGFA Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Brain. |
Product Guarantee and Expert Support
