VEGFA Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB584862
- Bilder (6)
| Artikelname: | VEGFA Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB584862 |
| Hersteller Artikelnummer: | orb584862 |
| Alternativnummer: | BYT-ORB584862-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Konjugation: | Unconjugated |
| Alternative Synonym: | VPF, VEGF, MVCD1 |
| Rabbit polyclonal antibody to VEGFA |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 40kDa |
| NCBI: | 001191314 |
| UniProt: | P15692 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVCDKPR |
| Target-Kategorie: | VEGFA |
|
|
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml. |
|
|
Positive control (+): Human Liver (LI), Negative control (-): Human Brain (BR), Antibody concentration: 3 ug/ml. |
|
|
Sample Type: LNCap cells, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:5000, Color/Signal Descriptions: Brown: VEGFA Blue: DAPI, Gene Name: VEGFA. |
|
|
WB Suggested Anti-VEGFA Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Brain. |
Produktgarantie und fachkundiger Support
