P4HB Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB580304
- Images (6)
| Article Name: | P4HB Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB580304 |
| Supplier Catalog Number: | orb580304 |
| Alternative Catalog Number: | BYT-ORB580304-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human P4HB |
| Conjugation: | Unconjugated |
| Alternative Names: | DSI, GIT, PDI, PHDB, PDIA1, PO4DB, PO4HB, PROHB, CLCRP1, ERBA2L, P4Hbeta |
| Rabbit polyclonal antibody to P4HB |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 55kDa |
| NCBI: | 000909 |
| UniProt: | P07237 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: TIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLV |
| Target: | P4HB |
|
|
Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml. |
|
|
Human kidney |
|
|
WB Suggested Anti-P4HB Antibody Titration: 0.5 ug/ml, Positive Control: HepG2 cell lysate. P4HB is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells. |
Product Guarantee and Expert Support
