P4HB Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB580304
- Bilder (6)
| Artikelname: | P4HB Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB580304 |
| Hersteller Artikelnummer: | orb580304 |
| Alternativnummer: | BYT-ORB580304-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human P4HB |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DSI, GIT, PDI, PHDB, PDIA1, PO4DB, PO4HB, PROHB, CLCRP1, ERBA2L, P4Hbeta |
| Rabbit polyclonal antibody to P4HB |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 55kDa |
| NCBI: | 000909 |
| UniProt: | P07237 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: TIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLV |
| Target-Kategorie: | P4HB |
|
|
Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Mouse Pancreas, Antibody dilution: 1 ug/ml. |
|
|
Human kidney |
|
|
WB Suggested Anti-P4HB Antibody Titration: 0.5 ug/ml, Positive Control: HepG2 cell lysate. P4HB is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells. |
Produktgarantie und fachkundiger Support
