Human HGF Protein

Catalog Number: BYT-ORB429387
Article Name: Human HGF Protein
Biozol Catalog Number: BYT-ORB429387
Supplier Catalog Number: orb429387
Alternative Catalog Number: BYT-ORB429387-0.1,BYT-ORB429387-10,BYT-ORB429387-2
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Scatter Factor (SF), Hepatopoietin (HPTA), HGF, HGFB, F-TCF.
Recombinant of human IL6 protein
Buffer: The sterile protein powder (1 mg/ml) is lyophilized from a solution containing 50mM acetic acid.
Purity: Greater than 95.0% as determined by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADN
Application Notes: Solubility: It is recommended to reconstitute the lyophilized Hepatocyte Growth Factor in 50mM acetic acid to a concentration not less than 100µg/ml. Further dilutions should be made using buffer containing protein. Biological Activity: The activity was assayed for scattering activity in the MDCK cell assay. The ED50 for this effect is typically at 2.0-5.0 ng/ml. Application Notes: Cytokines And Growth Factors