Human HGF Protein

Artikelnummer: BYT-ORB429387
Artikelname: Human HGF Protein
Artikelnummer: BYT-ORB429387
Hersteller Artikelnummer: orb429387
Alternativnummer: BYT-ORB429387-0.1,BYT-ORB429387-10,BYT-ORB429387-2
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Scatter Factor (SF), Hepatopoietin (HPTA), HGF, HGFB, F-TCF.
Recombinant of human IL6 protein
Puffer: The sterile protein powder (1 mg/ml) is lyophilized from a solution containing 50mM acetic acid.
Reinheit: Greater than 95.0% as determined by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADN
Anwendungsbeschreibung: Solubility: It is recommended to reconstitute the lyophilized Hepatocyte Growth Factor in 50mM acetic acid to a concentration not less than 100µg/ml. Further dilutions should be made using buffer containing protein. Biological Activity: The activity was assayed for scattering activity in the MDCK cell assay. The ED50 for this effect is typically at 2.0-5.0 ng/ml. Application Notes: Cytokines And Growth Factors