WNV Pre-M Protein

Catalog Number: BYT-ORB429247
Article Name: WNV Pre-M Protein
Biozol Catalog Number: BYT-ORB429247
Supplier Catalog Number: orb429247
Alternative Catalog Number: BYT-ORB429247-0.5,BYT-ORB429247-1,BYT-ORB429247-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Recombinant of WNV Pre-M protein
Buffer: 20mM phosphate buffer pH 7.5.
Purity: Protein is >95% pure as determined by SDS-PAGE.
Sequence: MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE
Application Notes: Application Notes: Applications: Antigen in ELISA and Western blots, excellent antigen for detection of West-Nile virus with minimal specificity problems