WNV Pre-M Protein

Artikelnummer: BYT-ORB429247
Artikelname: WNV Pre-M Protein
Artikelnummer: BYT-ORB429247
Hersteller Artikelnummer: orb429247
Alternativnummer: BYT-ORB429247-0.5,BYT-ORB429247-1,BYT-ORB429247-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Recombinant of WNV Pre-M protein
Puffer: 20mM phosphate buffer pH 7.5.
Reinheit: Protein is >95% pure as determined by SDS-PAGE.
Sequenz: MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE
Anwendungsbeschreibung: Application Notes: Applications: Antigen in ELISA and Western blots, excellent antigen for detection of West-Nile virus with minimal specificity problems