Human VEGF (121 a.a.) (Sf9) Protein

Catalog Number: BYT-ORB429177
Article Name: Human VEGF (121 a.a.) (Sf9) Protein
Biozol Catalog Number: BYT-ORB429177
Supplier Catalog Number: orb429177
Alternative Catalog Number: BYT-ORB429177-1,BYT-ORB429177-10,BYT-ORB429177-2
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGF, MGC70609.
Recombinant of human VEGF (121 a.a.) (Sf9) protein
Buffer: The protein was lyophilized from a solution containing 50mM acetic acid.
Purity: Greater than 95.0% as determined by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQEKCDKPRR
Application Notes: Solubility: The lyophilized VEGF121 should be reconstituted in 50mM acetic acid to a concentration not lower than 50µg/ml. Biological Activity: Measured in a cell proliferation assay using primary HUVECs. The ED50 for this effect is typically 2-10ng/ml. Application Notes: Cytokines And Growth Factors