Human VEGF (121 a.a.) (Sf9) Protein

Artikelnummer: BYT-ORB429177
Artikelname: Human VEGF (121 a.a.) (Sf9) Protein
Artikelnummer: BYT-ORB429177
Hersteller Artikelnummer: orb429177
Alternativnummer: BYT-ORB429177-1,BYT-ORB429177-10,BYT-ORB429177-2
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGF, MGC70609.
Recombinant of human VEGF (121 a.a.) (Sf9) protein
Puffer: The protein was lyophilized from a solution containing 50mM acetic acid.
Reinheit: Greater than 95.0% as determined by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQEKCDKPRR
Anwendungsbeschreibung: Solubility: The lyophilized VEGF121 should be reconstituted in 50mM acetic acid to a concentration not lower than 50µg/ml. Biological Activity: Measured in a cell proliferation assay using primary HUVECs. The ED50 for this effect is typically 2-10ng/ml. Application Notes: Cytokines And Growth Factors