Human UBE2L3 (His) Protein

Catalog Number: BYT-ORB429082
Article Name: Human UBE2L3 (His) Protein
Biozol Catalog Number: BYT-ORB429082
Supplier Catalog Number: orb429082
Alternative Catalog Number: BYT-ORB429082-1,BYT-ORB429082-10,BYT-ORB429082-50
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Ubiquitin-conjugating enzyme E2 L3, EC 6.3.2.19, Ubiquitin-protein ligase L3,Ubiquitin carrier protein L3, UbcH7, E2-F1, L-UBC, UbcM4.
Recombinant of human UBE2L3 (His) protein
Buffer: Lyophilized from a 0.2µm filtered concentrated (1 mg/ml) solution in 1X PBS and 1mM DTT, pH 7.5.
Purity: Greater than 95.0% as determined by: (a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Form: Sterile Filtered white lyophilized powder.
Sequence: MHHHHHHAMAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD
Application Notes: Solubility: It is recommended to reconstitute the lyophilized UBE2L3 in sterile water not less than 100µg/ml, which can then be further diluted to other aqueous solutions. Application Notes: Enzymes