Human UBE2L3 (His) Protein

Artikelnummer: BYT-ORB429082
Artikelname: Human UBE2L3 (His) Protein
Artikelnummer: BYT-ORB429082
Hersteller Artikelnummer: orb429082
Alternativnummer: BYT-ORB429082-1,BYT-ORB429082-10,BYT-ORB429082-50
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Ubiquitin-conjugating enzyme E2 L3, EC 6.3.2.19, Ubiquitin-protein ligase L3,Ubiquitin carrier protein L3, UbcH7, E2-F1, L-UBC, UbcM4.
Recombinant of human UBE2L3 (His) protein
Puffer: Lyophilized from a 0.2µm filtered concentrated (1 mg/ml) solution in 1X PBS and 1mM DTT, pH 7.5.
Reinheit: Greater than 95.0% as determined by: (a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Formulierung: Sterile Filtered white lyophilized powder.
Sequenz: MHHHHHHAMAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD
Anwendungsbeschreibung: Solubility: It is recommended to reconstitute the lyophilized UBE2L3 in sterile water not less than 100µg/ml, which can then be further diluted to other aqueous solutions. Application Notes: Enzymes