Human KLC3 protein

Catalog Number: BYT-ORB358834
Article Name: Human KLC3 protein
Biozol Catalog Number: BYT-ORB358834
Supplier Catalog Number: orb358834
Alternative Catalog Number: BYT-ORB358834-20,BYT-ORB358834-100,BYT-ORB358834-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: KLC2-like kinesin light chain 2
This Human KLC3 protein spans the amino acid sequence from region 1-504aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 71.4 kDa
UniProt: Q6P597
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSVQVAAPGSAGLGPERLSPEELVRQTRQVVQGLEALRAEHHGLAGHLAEALAGQGPAAGLEMLEEKQQVVSHSLEAIELGLGEAQVLLALSAHVGALEAEKQRLRSQARRLAQENVWLREELEETQRRLRASEESVAQLEEEKRHLEFLGQLRQYDPPAESQQSESPPRRDSLASLFPSEEEERKGPEAAGAAAAQQGGYEIPARLRTLHNLVIQYAGQGRYEVAVPLCRQALEDLERSSGHCHPDVATMLNIL
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.