Human KLC3 protein

Artikelnummer: BYT-ORB358834
Artikelname: Human KLC3 protein
Artikelnummer: BYT-ORB358834
Hersteller Artikelnummer: orb358834
Alternativnummer: BYT-ORB358834-20,BYT-ORB358834-100,BYT-ORB358834-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: KLC2-like kinesin light chain 2
This Human KLC3 protein spans the amino acid sequence from region 1-504aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 71.4 kDa
UniProt: Q6P597
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSVQVAAPGSAGLGPERLSPEELVRQTRQVVQGLEALRAEHHGLAGHLAEALAGQGPAAGLEMLEEKQQVVSHSLEAIELGLGEAQVLLALSAHVGALEAEKQRLRSQARRLAQENVWLREELEETQRRLRASEESVAQLEEEKRHLEFLGQLRQYDPPAESQQSESPPRRDSLASLFPSEEEERKGPEAAGAAAAQQGGYEIPARLRTLHNLVIQYAGQGRYEVAVPLCRQALEDLERSSGHCHPDVATMLNIL
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.