Bacterial Beta-lytic metalloendopeptidase protein

Catalog Number: BYT-ORB358783
Article Name: Bacterial Beta-lytic metalloendopeptidase protein
Biozol Catalog Number: BYT-ORB358783
Supplier Catalog Number: orb358783
Alternative Catalog Number: BYT-ORB358783-20,BYT-ORB358783-100,BYT-ORB358783-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Beta-lytic protease
This Bacterial Beta-lytic metalloendopeptidase protein spans the amino acid sequence from region 1-178aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 35.1 kDa
UniProt: P00801
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Lysobacter enzymogenes
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SPNGLLQFPFPRGASWHVGGAHTNTGSGNYPMSSLDMSRGGGSNQNGNWVSASAAGGSFKRHSSCFAEIVHTGGWSTTYYHLMNIQYNTGANVSMNTAIANAPNTQAQALCNGGQSTGPHQHWSLKQNGSFYHLNGTYLSGYRITATGSSYDTNCSRFYLTKNGQNYCYGYYVNPGPN
Application Notes: Biological Origin: Lysobacter enzymogenes. Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.