Bacterial Beta-lytic metalloendopeptidase protein

Artikelnummer: BYT-ORB358783
Artikelname: Bacterial Beta-lytic metalloendopeptidase protein
Artikelnummer: BYT-ORB358783
Hersteller Artikelnummer: orb358783
Alternativnummer: BYT-ORB358783-20,BYT-ORB358783-100,BYT-ORB358783-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Beta-lytic protease
This Bacterial Beta-lytic metalloendopeptidase protein spans the amino acid sequence from region 1-178aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 35.1 kDa
UniProt: P00801
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Lysobacter enzymogenes
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SPNGLLQFPFPRGASWHVGGAHTNTGSGNYPMSSLDMSRGGGSNQNGNWVSASAAGGSFKRHSSCFAEIVHTGGWSTTYYHLMNIQYNTGANVSMNTAIANAPNTQAQALCNGGQSTGPHQHWSLKQNGSFYHLNGTYLSGYRITATGSSYDTNCSRFYLTKNGQNYCYGYYVNPGPN
Anwendungsbeschreibung: Biological Origin: Lysobacter enzymogenes. Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.