Insect Glutathione S-transferase protein

Catalog Number: BYT-ORB358749
Article Name: Insect Glutathione S-transferase protein
Biozol Catalog Number: BYT-ORB358749
Supplier Catalog Number: orb358749
Alternative Catalog Number: BYT-ORB358749-20,BYT-ORB358749-100,BYT-ORB358749-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: GST class-sigma Major allergen Bla g 5 Allergen, Bla g 5
This Insect Glutathione S-transferase protein spans the amino acid sequence from region 2-204aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 25.2 kDa
UniProt: O18598
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Blattella germanica (German cockroach) (Blatta germanica)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: APSYKLTYCPVKALGEPIRFLLSYGEKDFEDYRFQEGDWPNLKPSMPFGKTPVLEIDGKQTHQSVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFRAAIANYHYDADENSKQKKWDPLKKETIPYYTKKFDEVVKANGGYLAAGKLTWADFYFVAILDYLNHMAKEDLVANQPNLKALREKVLGLPAIKAWVAKRPPTDL
Application Notes: Biological Origin: Blattella germanica (German cockroach) (Blatta germanica). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.