Insect Glutathione S-transferase protein

Artikelnummer: BYT-ORB358749
Artikelname: Insect Glutathione S-transferase protein
Artikelnummer: BYT-ORB358749
Hersteller Artikelnummer: orb358749
Alternativnummer: BYT-ORB358749-20,BYT-ORB358749-100,BYT-ORB358749-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: GST class-sigma Major allergen Bla g 5 Allergen, Bla g 5
This Insect Glutathione S-transferase protein spans the amino acid sequence from region 2-204aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 25.2 kDa
UniProt: O18598
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Blattella germanica (German cockroach) (Blatta germanica)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: APSYKLTYCPVKALGEPIRFLLSYGEKDFEDYRFQEGDWPNLKPSMPFGKTPVLEIDGKQTHQSVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFRAAIANYHYDADENSKQKKWDPLKKETIPYYTKKFDEVVKANGGYLAAGKLTWADFYFVAILDYLNHMAKEDLVANQPNLKALREKVLGLPAIKAWVAKRPPTDL
Anwendungsbeschreibung: Biological Origin: Blattella germanica (German cockroach) (Blatta germanica). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.