Mouse Sprr2a protein

Catalog Number: BYT-ORB358707
Article Name: Mouse Sprr2a protein
Biozol Catalog Number: BYT-ORB358707
Supplier Catalog Number: orb358707
Alternative Catalog Number: BYT-ORB358707-20,BYT-ORB358707-100,BYT-ORB358707-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Sprr2a1, Sprr2a, Small proline-rich protein 2A1, small proline-rich protein 2A
This Mouse Sprr2a protein spans the amino acid sequence from region 1-83aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 13.4 kDa
UniProt: Q9CQK8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSYYQQQCNQPCRPPPVCPPPKCPEPCPPQVWPGPCRPVMCFEPCLPSVWPGPCRPVVCYEQCPPQPWQSTCPPVQFPPCQQK
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.