Mouse Sprr2a protein

Artikelnummer: BYT-ORB358707
Artikelname: Mouse Sprr2a protein
Artikelnummer: BYT-ORB358707
Hersteller Artikelnummer: orb358707
Alternativnummer: BYT-ORB358707-20,BYT-ORB358707-100,BYT-ORB358707-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Sprr2a1, Sprr2a, Small proline-rich protein 2A1, small proline-rich protein 2A
This Mouse Sprr2a protein spans the amino acid sequence from region 1-83aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 13.4 kDa
UniProt: Q9CQK8
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSYYQQQCNQPCRPPPVCPPPKCPEPCPPQVWPGPCRPVMCFEPCLPSVWPGPCRPVVCYEQCPPQPWQSTCPPVQFPPCQQK
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.