Rat PHLPII protein

Catalog Number: BYT-ORB358694
Article Name: Rat PHLPII protein
Biozol Catalog Number: BYT-ORB358694
Supplier Catalog Number: orb358694
Alternative Catalog Number: BYT-ORB358694-20,BYT-ORB358694-100,BYT-ORB358694-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Allergen Phl p II Allergen, Phl p 2
This Rat PHLPII protein spans the amino acid sequence from region 27-122aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 26.8 kDa
UniProt: P43214
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Phleum pratense (Common timothy)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE
Application Notes: Biological Origin: Phleum pratense (Common timothy). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.