Rat PHLPII protein

Artikelnummer: BYT-ORB358694
Artikelname: Rat PHLPII protein
Artikelnummer: BYT-ORB358694
Hersteller Artikelnummer: orb358694
Alternativnummer: BYT-ORB358694-20,BYT-ORB358694-100,BYT-ORB358694-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Allergen Phl p II Allergen, Phl p 2
This Rat PHLPII protein spans the amino acid sequence from region 27-122aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 26.8 kDa
UniProt: P43214
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Phleum pratense (Common timothy)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE
Anwendungsbeschreibung: Biological Origin: Phleum pratense (Common timothy). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.