Rat PHLPI protein

Catalog Number: BYT-ORB358693
Article Name: Rat PHLPI protein
Biozol Catalog Number: BYT-ORB358693
Supplier Catalog Number: orb358693
Alternative Catalog Number: BYT-ORB358693-20,BYT-ORB358693-100,BYT-ORB358693-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Allergen Phl p I Allergen, Phl p 1
This Rat PHLPI protein spans the amino acid sequence from region 24-263aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 42.2 kDa
UniProt: P43213
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Phleum pratense (Common timothy)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: IPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVIPEGWKADTSYESK
Application Notes: Biological Origin: Phleum pratense (Common timothy). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.