Rat PHLPI protein

Artikelnummer: BYT-ORB358693
Artikelname: Rat PHLPI protein
Artikelnummer: BYT-ORB358693
Hersteller Artikelnummer: orb358693
Alternativnummer: BYT-ORB358693-20,BYT-ORB358693-100,BYT-ORB358693-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Allergen Phl p I Allergen, Phl p 1
This Rat PHLPI protein spans the amino acid sequence from region 24-263aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 42.2 kDa
UniProt: P43213
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Phleum pratense (Common timothy)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: IPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVIPEGWKADTSYESK
Anwendungsbeschreibung: Biological Origin: Phleum pratense (Common timothy). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.