Plant PRO1 protein

Catalog Number: BYT-ORB358692
Article Name: Plant PRO1 protein
Biozol Catalog Number: BYT-ORB358692
Supplier Catalog Number: orb358692
Alternative Catalog Number: BYT-ORB358692-20,BYT-ORB358692-100,BYT-ORB358692-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Pollen allergen Cyn d 12 Allergen, Cyn d 12
This Plant PRO1 protein spans the amino acid sequence from region 2-131aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 30 kDa
UniProt: O04725
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Cynodon dactylon (Bermuda grass) (Panicum dactylon)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIEKLGDYLIEQGM
Application Notes: Biological Origin: Cynodon dactylon (Bermuda grass) (Panicum dactylon). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.