Plant PRO1 protein

Artikelnummer: BYT-ORB358692
Artikelname: Plant PRO1 protein
Artikelnummer: BYT-ORB358692
Hersteller Artikelnummer: orb358692
Alternativnummer: BYT-ORB358692-20,BYT-ORB358692-100,BYT-ORB358692-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Pollen allergen Cyn d 12 Allergen, Cyn d 12
This Plant PRO1 protein spans the amino acid sequence from region 2-131aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 30 kDa
UniProt: O04725
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Cynodon dactylon (Bermuda grass) (Panicum dactylon)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIEKLGDYLIEQGM
Anwendungsbeschreibung: Biological Origin: Cynodon dactylon (Bermuda grass) (Panicum dactylon). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.