Mouse Adrbk1 protein

Catalog Number: BYT-ORB358678
Article Name: Mouse Adrbk1 protein
Biozol Catalog Number: BYT-ORB358678
Supplier Catalog Number: orb358678
Alternative Catalog Number: BYT-ORB358678-20,BYT-ORB358678-100,BYT-ORB358678-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: G-protein-coupled receptor kinase 2
This Mouse Adrbk1 protein spans the amino acid sequence from region 1-689aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 95.6 kDa
UniProt: Q99MK8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFSQKLGYLLFRDFCLNHLEEAKPLVEFYEEIKKYEKLETEEERVVRSREIFDSYIMKELLACSHPFSKNATEHVQGHLVKKQVPPDLFQPYIEEICQNLRGDVFQKFIESDKFTRFCQWKNVELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNERIMLSLVSTGDCPFIV
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.