Mouse Adrbk1 protein

Artikelnummer: BYT-ORB358678
Artikelname: Mouse Adrbk1 protein
Artikelnummer: BYT-ORB358678
Hersteller Artikelnummer: orb358678
Alternativnummer: BYT-ORB358678-20,BYT-ORB358678-100,BYT-ORB358678-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: G-protein-coupled receptor kinase 2
This Mouse Adrbk1 protein spans the amino acid sequence from region 1-689aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 95.6 kDa
UniProt: Q99MK8
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFSQKLGYLLFRDFCLNHLEEAKPLVEFYEEIKKYEKLETEEERVVRSREIFDSYIMKELLACSHPFSKNATEHVQGHLVKKQVPPDLFQPYIEEICQNLRGDVFQKFIESDKFTRFCQWKNVELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNERIMLSLVSTGDCPFIV
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.