Human SLURP1 protein

Catalog Number: BYT-ORB358668
Article Name: Human SLURP1 protein
Biozol Catalog Number: BYT-ORB358668
Supplier Catalog Number: orb358668
Alternative Catalog Number: BYT-ORB358668-20,BYT-ORB358668-100,BYT-ORB358668-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: ARS component B ARS(component B)-81/S Anti-neoplastic urinary protein Short name, ANUP
This Human SLURP1 protein spans the amino acid sequence from region 23-103aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 12.9 kDa
UniProt: P55000
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.