Human SLURP1 protein

Artikelnummer: BYT-ORB358668
Artikelname: Human SLURP1 protein
Artikelnummer: BYT-ORB358668
Hersteller Artikelnummer: orb358668
Alternativnummer: BYT-ORB358668-20,BYT-ORB358668-100,BYT-ORB358668-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: ARS component B ARS(component B)-81/S Anti-neoplastic urinary protein Short name, ANUP
This Human SLURP1 protein spans the amino acid sequence from region 23-103aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 12.9 kDa
UniProt: P55000
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.