FZD4 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB330168
- Images (7)
| Article Name: | FZD4 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB330168 |
| Supplier Catalog Number: | orb330168 |
| Alternative Catalog Number: | BYT-ORB330168-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human FZD4 |
| Conjugation: | Unconjugated |
| Alternative Names: | anti EVR1 antibody, anti FEVR antibody, anti FZD4S antibody, anti Fz-4 antibody, anti FzE4 antibody, anti GPCR antibody, anti MGC34390 antibody, anti CD344 antibody |
| Rabbit polyclonal antibody to FZD4 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 60 kDa |
| NCBI: | 036325 |
| UniProt: | Q9ULV1 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV |
| Target: | FZD4 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. |
|
|
Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Tissue: Human Lung Tumor, Antibody Dilution: 1 ug/mL. |
|
|
Sample Tissue: Human RPMI 8226 Whole Cell, Antibody Dilution: 3 ug/mL. |
|
|
Positive control (+): Human lung (LU), Negative control (-): 293T (2T), Antibody concentration: 1 ug/mL. |
|
|
Skin |
|
|
WB Suggested Anti-FZD4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Fetal Liver. |
Product Guarantee and Expert Support
