FZD4 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB330168
- Bilder (7)
| Artikelname: | FZD4 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB330168 |
| Hersteller Artikelnummer: | orb330168 |
| Alternativnummer: | BYT-ORB330168-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human FZD4 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti EVR1 antibody, anti FEVR antibody, anti FZD4S antibody, anti Fz-4 antibody, anti FzE4 antibody, anti GPCR antibody, anti MGC34390 antibody, anti CD344 antibody |
| Rabbit polyclonal antibody to FZD4 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 60 kDa |
| NCBI: | 036325 |
| UniProt: | Q9ULV1 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV |
| Target-Kategorie: | FZD4 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. |
|
|
Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Tissue: Human Lung Tumor, Antibody Dilution: 1 ug/mL. |
|
|
Sample Tissue: Human RPMI 8226 Whole Cell, Antibody Dilution: 3 ug/mL. |
|
|
Positive control (+): Human lung (LU), Negative control (-): 293T (2T), Antibody concentration: 1 ug/mL. |
|
|
Skin |
|
|
WB Suggested Anti-FZD4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Fetal Liver. |
Produktgarantie und fachkundiger Support
