UNC84A Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB325524
- Images (7)
| Article Name: | UNC84A Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB325524 |
| Supplier Catalog Number: | orb325524 |
| Alternative Catalog Number: | BYT-ORB325524-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human UNC84A |
| Conjugation: | Unconjugated |
| Alternative Names: | anti FLJ12407 antibody, anti KIAA0810 antibody, anti MGC176649 antibody, anti SUN1 antibody, anti UNC84A antibody |
| Rabbit polyclonal antibody to SUN1 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 90kDa |
| NCBI: | 079430 |
| UniProt: | O94901 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: QDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGA |
| Target: | SUN1 |
|
|
Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/mL. |
|
|
Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/mL. |
|
|
Sample Type: Jurkat Whole Cell lysates, Antibody Dilution: 3 ug/mL. |
|
|
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Mouse C2C12 cells, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 488, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: UNC84a: Green DAPI: Blue, Gene Name: UNC84A. |
|
|
WB Suggested Anti-UNC84A Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate. |
Product Guarantee and Expert Support
