UNC84A Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB325524
- Bilder (7)
| Artikelname: | UNC84A Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB325524 |
| Hersteller Artikelnummer: | orb325524 |
| Alternativnummer: | BYT-ORB325524-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human UNC84A |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti FLJ12407 antibody, anti KIAA0810 antibody, anti MGC176649 antibody, anti SUN1 antibody, anti UNC84A antibody |
| Rabbit polyclonal antibody to SUN1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 90kDa |
| NCBI: | 079430 |
| UniProt: | O94901 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: QDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGA |
| Target-Kategorie: | SUN1 |
|
|
Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/mL. |
|
|
Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/mL. |
|
|
Sample Type: Jurkat Whole Cell lysates, Antibody Dilution: 3 ug/mL. |
|
|
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Mouse C2C12 cells, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 488, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: UNC84a: Green DAPI: Blue, Gene Name: UNC84A. |
|
|
WB Suggested Anti-UNC84A Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate. |
Produktgarantie und fachkundiger Support
