PLP1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324495
| Article Name: |
PLP1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324495 |
| Supplier Catalog Number: |
orb324495 |
| Alternative Catalog Number: |
BYT-ORB324495-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human, Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human PLP1 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti MMPL antibody, anti PLP antibody, anti PLP/DM20 antibody, anti PMD antibody, anti SPG2 antibody, anti HLD1 antibody |
| Rabbit polyclonal antibody to PLP1 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
30kDa |
| NCBI: |
000524 |
| UniProt: |
P60201 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: GHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGAL |
| Target: |
PLP1 |
|
Brain, cerebellum. |
|
Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/mL. |
|
Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 3 ug/mL. |
|
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 0.5 ug/mL. |
|
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/mL. |
|
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/mL. |
|
WB Suggested Anti-PLP1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate. |