PLP1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324495
- Images (7)
| Article Name: | PLP1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB324495 |
| Supplier Catalog Number: | orb324495 |
| Alternative Catalog Number: | BYT-ORB324495-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human PLP1 |
| Conjugation: | Unconjugated |
| Alternative Names: | anti MMPL antibody, anti PLP antibody, anti PLP/DM20 antibody, anti PMD antibody, anti SPG2 antibody, anti HLD1 antibody |
| Rabbit polyclonal antibody to PLP1 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 30kDa |
| NCBI: | 000524 |
| UniProt: | P60201 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: GHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGAL |
| Target: | PLP1 |
|
|
Brain, cerebellum. |
|
|
Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/mL. |
|
|
Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 3 ug/mL. |
|
|
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 0.5 ug/mL. |
|
|
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/mL. |
|
|
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/mL. |
|
|
WB Suggested Anti-PLP1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate. |
Product Guarantee and Expert Support
