PLP1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324495
- Bilder (7)
| Artikelname: | PLP1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB324495 |
| Hersteller Artikelnummer: | orb324495 |
| Alternativnummer: | BYT-ORB324495-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human PLP1 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti MMPL antibody, anti PLP antibody, anti PLP/DM20 antibody, anti PMD antibody, anti SPG2 antibody, anti HLD1 antibody |
| Rabbit polyclonal antibody to PLP1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 30kDa |
| NCBI: | 000524 |
| UniProt: | P60201 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: GHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGAL |
| Target-Kategorie: | PLP1 |
|
|
Brain, cerebellum. |
|
|
Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/mL. |
|
|
Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 3 ug/mL. |
|
|
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 0.5 ug/mL. |
|
|
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/mL. |
|
|
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/mL. |
|
|
WB Suggested Anti-PLP1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate. |
Produktgarantie und fachkundiger Support
