REST Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2139975
Article Name: REST Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2139975
Supplier Catalog Number: orb2139975
Alternative Catalog Number: BYT-ORB2139975-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human REST
Conjugation: Biotin
Alternative Names: WT6, XBR, HGF5, NRSF, DFNA27, GINGF5
REST Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 122kDa
NCBI: 005603
UniProt: Q13127
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PMLPPSAVEEREAVSKTALASPPATMAANESQEIDEDEGIHSHEGSDLSD