REST Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2139975
Artikelname: REST Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2139975
Hersteller Artikelnummer: orb2139975
Alternativnummer: BYT-ORB2139975-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human REST
Konjugation: Biotin
Alternative Synonym: WT6, XBR, HGF5, NRSF, DFNA27, GINGF5
REST Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 122kDa
NCBI: 005603
UniProt: Q13127
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PMLPPSAVEEREAVSKTALASPPATMAANESQEIDEDEGIHSHEGSDLSD