Human HLA G protein

Catalog Number: BYT-ORB10317
Article Name: Human HLA G protein
Biozol Catalog Number: BYT-ORB10317
Supplier Catalog Number: orb10317
Alternative Catalog Number: BYT-ORB10317-20,BYT-ORB10317-100,BYT-ORB10317-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: HLA G antigen MHC class I antigen G
This Human HLA G protein spans the amino acid sequence from region 25-338aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 39.6 kDa
UniProt: P17693
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQ
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Tag info: N-terminal 6xHis-SUMO-taggedExpression Region: 25-338aaSequence Info: partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-G.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-G.
SDS-Page analysis of Human HLA G protein.