Human HLA G protein

Artikelnummer: BYT-ORB10317
Artikelname: Human HLA G protein
Artikelnummer: BYT-ORB10317
Hersteller Artikelnummer: orb10317
Alternativnummer: BYT-ORB10317-20,BYT-ORB10317-100,BYT-ORB10317-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: HLA G antigen MHC class I antigen G
This Human HLA G protein spans the amino acid sequence from region 25-338aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 39.6 kDa
UniProt: P17693
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQ
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Tag info: N-terminal 6xHis-SUMO-taggedExpression Region: 25-338aaSequence Info: partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-G.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-G.
SDS-Page analysis of Human HLA G protein.