Recombinant Influenza B virus Nuclear export protein (NS), Unconjugated, E. coli

Catalog Number: BIM-RPC26241
Article Name: Recombinant Influenza B virus Nuclear export protein (NS), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC26241
Supplier Catalog Number: RPC26241
Alternative Catalog Number: BIM-RPC26241-20UG,BIM-RPC26241-100UG,BIM-RPC26241-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: Non-structural protein 2 (NS2, NEP)
Recombinant Influenza B virus Nuclear export protein (NS) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Influenza B virus (strain B/Yamagata/1/1973). Target Name: NS. Target Synonyms: Non-structural protein 2 (NS2, NEP). Accession Number: P08014. Expression Region: 1~122aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 21.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 21.8kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MADNMTTTQIEWRMKKMAIGSSTHSSSVLMKDIQSQFEQLKLRWESYPNLVKSTDYHQRRETIRLVTEELYLLSKRIDDNILFHKTVIANSSIIADMIVSLSLLETLYEMKDVVEVYSRQCL
Target: NS