Recombinant Influenza B virus Nuclear export protein (NS), Unconjugated, E. coli

Artikelnummer: BIM-RPC26241
Artikelname: Recombinant Influenza B virus Nuclear export protein (NS), Unconjugated, E. coli
Artikelnummer: BIM-RPC26241
Hersteller Artikelnummer: RPC26241
Alternativnummer: BIM-RPC26241-20UG,BIM-RPC26241-100UG,BIM-RPC26241-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: Non-structural protein 2 (NS2, NEP)
Recombinant Influenza B virus Nuclear export protein (NS) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Influenza B virus (strain B/Yamagata/1/1973). Target Name: NS. Target Synonyms: Non-structural protein 2 (NS2, NEP). Accession Number: P08014. Expression Region: 1~122aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 21.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 21.8kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MADNMTTTQIEWRMKKMAIGSSTHSSSVLMKDIQSQFEQLKLRWESYPNLVKSTDYHQRRETIRLVTEELYLLSKRIDDNILFHKTVIANSSIIADMIVSLSLLETLYEMKDVVEVYSRQCL
Target-Kategorie: NS