Recombinant Human C-X-C chemokine receptor type 3 (CXCR3), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CXCR3. Target Synonyms: CKR-L2 (G protein-coupled receptor 9, Interferon-inducible protein 10 receptor, IP-10 receptor, CD_antigen: CD183, CXC-R3, CXCR-3, GPR9). Accession Number: P49682. Expression Region: 4~50aa. Tag Info: N-Terminal 6Xhis-Gst-Tagged. Theoretical MW: 36.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight:
36.6kDa
Tag:
N-Terminal 6Xhis-Gst-Tagged
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity:
>85% by SDS-PAGE
Sequence:
EVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLN
Target:
CXCR3
* VAT and and shipping costs not included. Errors and price changes excepted
