Recombinant Human C-X-C chemokine receptor type 3 (CXCR3), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC26211
Artikelname: Recombinant Human C-X-C chemokine receptor type 3 (CXCR3), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC26211
Hersteller Artikelnummer: RPC26211
Alternativnummer: BIM-RPC26211-20UG,BIM-RPC26211-100UG,BIM-RPC26211-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: CKR-L2 (G protein-coupled receptor 9, Interferon-inducible protein 10 receptor, IP-10 receptor, CD_antigen: CD183, CXC-R3, CXCR-3, GPR9)
Recombinant Human C-X-C chemokine receptor type 3 (CXCR3), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CXCR3. Target Synonyms: CKR-L2 (G protein-coupled receptor 9, Interferon-inducible protein 10 receptor, IP-10 receptor, CD_antigen: CD183, CXC-R3, CXCR-3, GPR9). Accession Number: P49682. Expression Region: 4~50aa. Tag Info: N-Terminal 6Xhis-Gst-Tagged. Theoretical MW: 36.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 36.6kDa
Tag: N-Terminal 6Xhis-Gst-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: EVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLN
Target-Kategorie: CXCR3