Recombinant Human Inhibitor of nuclear factor kappa-B kinase subunit beta (IKBKB), Unconjugated, E. coli

Catalog Number: BIM-RPC26196
Article Name: Recombinant Human Inhibitor of nuclear factor kappa-B kinase subunit beta (IKBKB), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC26196
Supplier Catalog Number: RPC26196
Alternative Catalog Number: BIM-RPC26196-20UG,BIM-RPC26196-100UG,BIM-RPC26196-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: I-kappa-B kinase 2 (IKK2, Nuclear factor NF-kappa-B inhibitor kinase beta, NFKBIKB, I-kappa-B-kinase beta, IKK-B, IKK-beta, IkBKB, IKKB)
Recombinant Human Inhibitor of nuclear factor kappa-B kinase subunit beta (IKBKB) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: IKBKB. Target Synonyms: I-kappa-B kinase 2 (IKK2, Nuclear factor NF-kappa-B inhibitor kinase beta, NFKBIKB, I-kappa-B-kinase beta, IKK-B, IKK-beta, IkBKB, IKKB). Accession Number: O14920. Expression Region: 1~756aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 92.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 92.5kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDLNGTVKF
Target: IKBKB