Recombinant Human Inhibitor of nuclear factor kappa-B kinase subunit beta (IKBKB), Unconjugated, E. coli

Artikelnummer: BIM-RPC26196
Artikelname: Recombinant Human Inhibitor of nuclear factor kappa-B kinase subunit beta (IKBKB), Unconjugated, E. coli
Artikelnummer: BIM-RPC26196
Hersteller Artikelnummer: RPC26196
Alternativnummer: BIM-RPC26196-20UG,BIM-RPC26196-100UG,BIM-RPC26196-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: I-kappa-B kinase 2 (IKK2, Nuclear factor NF-kappa-B inhibitor kinase beta, NFKBIKB, I-kappa-B-kinase beta, IKK-B, IKK-beta, IkBKB, IKKB)
Recombinant Human Inhibitor of nuclear factor kappa-B kinase subunit beta (IKBKB) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: IKBKB. Target Synonyms: I-kappa-B kinase 2 (IKK2, Nuclear factor NF-kappa-B inhibitor kinase beta, NFKBIKB, I-kappa-B-kinase beta, IKK-B, IKK-beta, IkBKB, IKKB). Accession Number: O14920. Expression Region: 1~756aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 92.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 92.5kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDLNGTVKF
Target-Kategorie: IKBKB