Recombinant Human Deoxyribonuclease gamma (DNASE1L3), Unconjugated, E. coli

Catalog Number: BIM-RPC26147
Article Name: Recombinant Human Deoxyribonuclease gamma (DNASE1L3), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC26147
Supplier Catalog Number: RPC26147
Alternative Catalog Number: BIM-RPC26147-20UG,BIM-RPC26147-100UG,BIM-RPC26147-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: DNase I homolog protein DHP2 (Deoxyribonuclease I-like 3, DNase I-like 3, Liver and spleen DNase, LS-DNase, LSD, DNase gamma, DHP2, DNAS1L3)
Recombinant Human Deoxyribonuclease gamma (DNASE1L3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: DNASE1L3. Target Synonyms: DNase I homolog protein DHP2 (Deoxyribonuclease I-like 3, DNase I-like 3, Liver and spleen DNase, LS-DNase, LSD, DNase gamma, DHP2, DNAS1L3). Accession Number: Q13609. Expression Region: 21~305aa. Tag Info: Tag-Free. Theoretical MW: 33.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 33.4kDa
Tag: Tag-Free
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHF
Target: DNASE1L3