Recombinant Human Deoxyribonuclease gamma (DNASE1L3), Unconjugated, E. coli

Artikelnummer: BIM-RPC26147
Artikelname: Recombinant Human Deoxyribonuclease gamma (DNASE1L3), Unconjugated, E. coli
Artikelnummer: BIM-RPC26147
Hersteller Artikelnummer: RPC26147
Alternativnummer: BIM-RPC26147-20UG,BIM-RPC26147-100UG,BIM-RPC26147-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: DNase I homolog protein DHP2 (Deoxyribonuclease I-like 3, DNase I-like 3, Liver and spleen DNase, LS-DNase, LSD, DNase gamma, DHP2, DNAS1L3)
Recombinant Human Deoxyribonuclease gamma (DNASE1L3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: DNASE1L3. Target Synonyms: DNase I homolog protein DHP2 (Deoxyribonuclease I-like 3, DNase I-like 3, Liver and spleen DNase, LS-DNase, LSD, DNase gamma, DHP2, DNAS1L3). Accession Number: Q13609. Expression Region: 21~305aa. Tag Info: Tag-Free. Theoretical MW: 33.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 33.4kDa
Tag: Tag-Free
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHF
Target-Kategorie: DNASE1L3