Recombinant Human Calcium-activated potassium channel subunit alpha-1 (KCNMA1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC26142
Article Name: Recombinant Human Calcium-activated potassium channel subunit alpha-1 (KCNMA1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC26142
Supplier Catalog Number: RPC26142
Alternative Catalog Number: BIM-RPC26142-20UG,BIM-RPC26142-100UG,BIM-RPC26142-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: BK channel (BKCA alpha, Calcium-activated potassium channel, subfamily M subunit alpha-1, K(VCA)alpha, KCa1.1, Maxi K channel, MaxiK, Slo-alpha, Slo1, Slowpoke homolog, Slo homolog, hSlo, KCNMA, SLO)
Recombinant Human Calcium-activated potassium channel subunit alpha-1 (KCNMA1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: KCNMA1. Target Synonyms: BK channel (BKCA alpha, Calcium-activated potassium channel, subfamily M subunit alpha-1, K(VCA)alpha, KCa1.1, Maxi K channel, MaxiK, Slo-alpha, Slo1, Slowpoke homolog, Slo homolog, hSlo, KCNMA, SLO). Accession Number: Q12791. Expression Region: 411~560aa. Tag Info: C-Terminal 6Xhis-Hpc4-Tagged. Theoretical MW: 20.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 20.0kDa
Tag: C-Terminal 6Xhis-Hpc4-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: VVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIA
Target: KCNMA1