Recombinant Human Calcium-activated potassium channel subunit alpha-1 (KCNMA1), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC26142
Artikelname: Recombinant Human Calcium-activated potassium channel subunit alpha-1 (KCNMA1), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC26142
Hersteller Artikelnummer: RPC26142
Alternativnummer: BIM-RPC26142-20UG,BIM-RPC26142-100UG,BIM-RPC26142-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: BK channel (BKCA alpha, Calcium-activated potassium channel, subfamily M subunit alpha-1, K(VCA)alpha, KCa1.1, Maxi K channel, MaxiK, Slo-alpha, Slo1, Slowpoke homolog, Slo homolog, hSlo, KCNMA, SLO)
Recombinant Human Calcium-activated potassium channel subunit alpha-1 (KCNMA1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: KCNMA1. Target Synonyms: BK channel (BKCA alpha, Calcium-activated potassium channel, subfamily M subunit alpha-1, K(VCA)alpha, KCa1.1, Maxi K channel, MaxiK, Slo-alpha, Slo1, Slowpoke homolog, Slo homolog, hSlo, KCNMA, SLO). Accession Number: Q12791. Expression Region: 411~560aa. Tag Info: C-Terminal 6Xhis-Hpc4-Tagged. Theoretical MW: 20.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 20.0kDa
Tag: C-Terminal 6Xhis-Hpc4-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: VVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIA
Target-Kategorie: KCNMA1